PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01623.1.g00040.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 249aa    MW: 27748.9 Da    PI: 6.7181
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01623.1.g00040.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.25.8e-161461148
                                    TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                 Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                    rg+WT+eEd  lv  ++ +G  +W++ ++  g+ R++k+c++rw +yl
  Zmw_sc01623.1.g00040.1.sm.mkhc 14 RGPWTPEEDRVLVAHIESHGHSNWRALPKQAGLLRCGKSCRLRWINYL 61
                                    89******************************99************97 PP

2Myb_DNA-binding51.91.7e-1667111147
                                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                 Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                     rg++T eE++ +++++++lG++ W++Ia++++ gRt++++k+ w++ 
  Zmw_sc01623.1.g00040.1.sm.mkhc  67 RGNFTREEEDAIIQLHHMLGNR-WSAIAARLP-GRTDNEIKNVWHTN 111
                                     89********************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.3E-25564IPR009057Homeodomain-like
PROSITE profilePS5129416.139961IPR017930Myb domain
SuperFamilySSF466892.85E-3010108IPR009057Homeodomain-like
SMARTSM007171.1E-121363IPR001005SANT/Myb domain
PfamPF002495.6E-141461IPR001005SANT/Myb domain
CDDcd001671.28E-101661No hitNo description
PROSITE profilePS5129424.92762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-2565116IPR009057Homeodomain-like
SMARTSM007177.7E-1566114IPR001005SANT/Myb domain
PfamPF002491.6E-1567111IPR001005SANT/Myb domain
CDDcd001672.57E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MGRAPCCEKM GLKRGPWTPE EDRVLVAHIE SHGHSNWRAL PKQAGLLRCG KSCRLRWINY  60
LRPDIKRGNF TREEEDAIIQ LHHMLGNRWS AIAARLPGRT DNEIKNVWHT NLKKRLEPKP  120
SNPQQASKRS RHKKQRHEVV LPNGPTAVPV SPEQSLSTTT TSAATTDYSA ASSSSTLENA  180
DSFSSEEFQI DDSFWSETLA MPVDSSDSSG VETGDDFGAL SAPSSSDDMD FWLQVFMQAG  240
GVENYLPQI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-261211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001296459.11e-124myb-related protein Myb4
SwissprotQ7XBH41e-104MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLA0A060CYS61e-124A0A060CYS6_MAIZE; MYB transcription factor (Fragment)
STRINGGRMZM2G095904_P011e-124(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563